General Information

  • ID:  hor006282
  • Uniprot ID:  Q62923
  • Protein name:  Neuropeptide 2
  • Gene name:  Pnoc
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Opioid neuropeptide precursor family
  • Source:  Animal
  • Expression:  Expressed predominantly in the spinal cord and brain, being more abundant in the hypothalamus and striatum. Also found in small amounts in ovary.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001515 opioid peptide activity; GO:0031628 opioid receptor binding; GO:0048018 receptor ligand activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007270 neuron-neuron synaptic transmission; GO:0007565 female pregnancy; GO:0007600 sensory perception; GO:0019233 sensory perception of pain
  • GO CC:  GO:0005576 extracellular region; GO:0005886 plasma membrane; GO:0030425 dendrite; GO:0043025 neuronal cell body; GO:0043679 axon terminus; GO:0045202 synapse; GO:0097060 synaptic membrane

Sequence Information

  • Sequence:  FSEFMRQYLVLSMQSSQ
  • Length:  17(154-170)
  • Propeptide:  MKILFCDVLLLSLLSSVFSSCPEDCLTCQERLHPAPGSFNLKLCILQCEEKVFPRPLWTLCTKAMASDSEQLSPADPELTSAALYQSKASEMQHLKRMPRVRSVVQARDAEPEADAEPVADEADEVEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV
  • Signal peptide:  MKILFCDVLLLSLLSSVFS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Nociceptin]: Ligand of the opioid receptor-like receptor OPRL1. It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neuronal differentiation and development.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Oprl1
  • Target Unid:  P35370
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q62923-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006282_AF2.pdbhor006282_ESM.pdb

Physical Information

Mass: 236694 Formula: C92H141N23O28S2
Absent amino acids: ACDGHIKNPTW Common amino acids: S
pI: 6.4 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -10.59 Boman Index: -2755
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 62.94
Instability Index: 6727.06 Extinction Coefficient cystines: 1490
Absorbance 280nm: 93.13

Literature

  • PubMed ID:  8710930
  • Title:  Primary structure and tissue distribution of the orphanin FQ precursor.
  • PubMed ID:  8710928
  • Title:  Structure, tissue distribution, and chromosomal localization of the prepronociceptin gene.
  • PubMed ID:  7566152
  • Title:  Isolation and structure of the endogenous agonist of opioid receptor-like ORL1 receptor.